GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
0 items
New Products

(3) wood cuts,sublimation and crafts | Facebook

Product Details
Keep your Crocs organized and stylish with our MDF charm holder £5
Keep your Crocs organized and stylish with our MDF charm holder £5
Keep your Crocs organized and stylish with our MDF charm holder £5
Keep your Crocs organized and stylish with our MDF charm holder £5
Product Code:nyWRniu
Product Condition:New
£5.00
Add to Cart
Description
🌟 MDF Croc Charm Holder

Keep your Crocs organized and stylish with our MDF charm holder! Designed to hold your favorite charms securely, it’s the perfect accessory for your footwear. Whether you’re a superhero fan or love cute designs, our MDF holder has you covered. Get yours today and personalize your Crocs like never before! £5

https://www.facebook.com/groups/www.woodblanks.co.uk

Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i