GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
0 items
New Products

(3) wood cuts,sublimation and crafts | Facebook

Product Details
mdf parents to be bauble round or heart shaped comes with hanging string £1.50 each
mdf parents to be bauble round or heart shaped comes with hanging string £1.50 each
mdf parents to be bauble round or heart shaped comes with hanging string £1.50 each
mdf parents to be bauble round or heart shaped comes with hanging string £1.50 each
Product Code:ZlFWRbf
Product Condition:New
£1.50 inc. tax
Add to Cart
Description

mdf parents to be bauble round or heart shaped comes with hanging string £1.50 each 

Updating Order Details
Please do not refresh or navigate away from the page!

https://www.facebook.com/groups/www.woodblanks.co.uk

Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i